MacroDesign
Back to Home

Protein Structure Discovery

Advanced tools and methodologies for predicting, analyzing, and visualizing protein structures

Understanding Protein Structures

Protein structure determination is fundamental to understanding biological processes and developing therapeutics. Our platform integrates cutting-edge computational methods with experimental data to provide accurate structural models.

From primary sequence to tertiary structure, our tools help researchers navigate the complex landscape of protein folding and structural biology with unprecedented accuracy and speed.

AI-Powered Predictions

Leverage state-of-the-art machine learning models for structure prediction

Multi-Scale Analysis

Analyze structures from amino acid residues to complex assemblies

Interactive Visualization

Explore protein structures with our advanced 3D visualization tools

Protein structure visualization

Key Features

Our platform offers a comprehensive suite of tools for protein structure discovery and analysis

Sequence Analysis
From sequence to structure prediction
  • 1
    Multiple sequence alignment with homology detection
  • 2
    Secondary structure prediction from sequence
  • 3
    Domain identification and functional annotation
  • 4
    Evolutionary conservation analysis
Structure Prediction
Advanced modeling techniques
  • 1
    AI-powered tertiary structure prediction
  • 2
    Template-based modeling with refinement
  • 3
    Ab initio modeling for novel proteins
  • 4
    Quality assessment and model validation
Structure Analysis
Comprehensive analytical tools
  • 1
    Binding site prediction and analysis
  • 2
    Protein-protein interaction interface mapping
  • 3
    Structural comparison and classification
  • 4
    Electrostatic and hydrophobic surface analysis

Our Workflow

From sequence to structure, our platform guides you through every step of the protein structure discovery process

Sequence Input & Analysis

Start with a protein sequence or identifier. Our platform automatically retrieves and analyzes the sequence, providing insights into its composition, domains, and evolutionary conservation.

>Protein_XYZ
MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG
1
2

Structure Prediction

Our AI-powered prediction engine generates accurate 3D models of your protein. Choose from multiple prediction methods or combine them for ensemble predictions.

AlphaFold Integration
RoseTTAFold
ESMFold
Custom Models

Model Refinement

Refine your predicted structures with molecular dynamics simulations and energy minimization. Validate models against experimental data and structural quality metrics.

Energy Minimization
Loop Refinement
Side Chain Optimization
3
4

Analysis & Visualization

Explore your protein structures with our interactive 3D viewer. Analyze binding sites, electrostatic surfaces, and structural motifs. Compare with similar structures from databases.

Applications & Use Cases

Our protein structure discovery platform supports a wide range of research and development applications

Drug Discovery & Development

Accelerate your drug discovery pipeline with accurate protein structure models. Identify binding sites, screen virtual compounds, and optimize lead molecules with our comprehensive suite of tools.

  • Target identification and validation
  • Binding site analysis and druggability assessment
  • Structure-based virtual screening
  • Lead optimization with structural insights
Drug discovery visualization

Ready to Discover Protein Structures?

Join our platform today and access cutting-edge tools for protein structure prediction, analysis, and visualization.